PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0340s0160.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARF
Protein Properties Length: 787aa    MW: 88568.5 Da    PI: 6.6143
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0340s0160.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.16.8e-23139240199
                             EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEE CS
                      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvv 81 
                             f+k lt sd++++g +++ k++a+e+      +++++  ++l+ +d++g++W++++i+r++++r++l++GW+ Fv+a++L +gD ++
  SapurV1A.0340s0160.2.p 139 FCKMLTASDTSTHGGFSVLKRHADEClppldmSLQPPA-QELVAKDLHGNEWRFRHIFRGQPKRHLLQSGWSLFVSAKKLVAGDAFI 224
                             89*****************************9666665.59********************************************** PP

                             EEE-SSSEE..EEEEE-S CS
                      B3  82 Fkldgrsefelvvkvfrk 99 
                             F   + +++el+v+v+r+
  SapurV1A.0340s0160.2.p 225 FL--RGDTEELRVGVRRA 240
                             **..3378888****985 PP

2Auxin_resp115.64.3e-38265347183
              Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                             a+ha+st+s+F+v+Y+Pr s++eF+++++k+++++k+++ +GmRfkm+fe e++ e+rlsGtv+gv+++dp +Wp+SkWr+Lk
  SapurV1A.0340s0160.2.p 265 AWHAVSTGSMFTVYYKPRNSPAEFIIPIDKYRESVKINYDIGMRFKMKFEAEEATEQRLSGTVTGVEEVDPKKWPRSKWRCLK 347
                             89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.9E-38133254IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.71E-39133268IPR015300DNA-binding pseudobarrel domain
CDDcd100173.48E-20137239No hitNo description
PfamPF023627.3E-21139240IPR003340B3 DNA binding domain
SMARTSM010197.3E-21139241IPR003340B3 DNA binding domain
PROSITE profilePS5086311.561139241IPR003340B3 DNA binding domain
PfamPF065071.3E-34265347IPR010525Auxin response factor
PfamPF023093.6E-10659753IPR033389AUX/IAA domain
SuperFamilySSF542771.18E-11660739No hitNo description
PROSITE profilePS5174524.719662744IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 787 aa     Download sequence    Send to blast
MNNGSYSVDT KPNGIAGGSW SSPVAGEGSE DALYKELWHA CAGPLVTVPR QGELVYYFPQ  60
GHIEQVEAST NQVADDQQMP SYNLPPKILC RVVNVQLKAE LDTDEVFAQV ILLPEAHQDV  120
DLVEEDLPPP PARPRVHSFC KMLTASDTST HGGFSVLKRH ADECLPPLDM SLQPPAQELV  180
AKDLHGNEWR FRHIFRGQPK RHLLQSGWSL FVSAKKLVAG DAFIFLRGDT EELRVGVRRA  240
LSQPSNVPSS VISSHSMHIG ILATAWHAVS TGSMFTVYYK PRNSPAEFII PIDKYRESVK  300
INYDIGMRFK MKFEAEEATE QRLSGTVTGV EEVDPKKWPR SKWRCLKVRW DETSPVHRPE  360
RVSPWRIEPA LAPSLDPVPG CRSKRHRSNM ATPSADSSAP PKKDNEPSRH LQHQEIMTLR  420
NMYDGKNYSD GNHNHAWALS QGKDQTTFDN RKFGPDDKIP QVWHGSRLMN PTTGPGTLRE  480
SYESTHPFFE LNSDDIDHPS KLNGTGVFNC HSAPLMYSDH SFNMMASRME VHLEKDKDIQ  540
QQRGSWFSPF RNADNSSKPQ HLPFQQRNGE TSKDGNCKLF GFSLFGNPVA VEPAIINRHS  600
TDKQQQQINV ASDHLQLLGS EGFLEQVKHP KHARCEEQGN IFQASALHSK VVQGMPKGDS  660
TRRCVKVYKQ GTAVGRSLDL AKLNGYNELT AELDQIFEFH GELVAPYKDW LIVFTDDEGD  720
MMLVGDDPWQ EFCSMVRRIF VFTREEINRM EPRSLNLEAR GDSRSTDQMV DSMEDGTSNH  780
LQAVSP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-164153691354Auxin response factor 1
4ldw_A1e-164153691354Auxin response factor 1
4ldw_B1e-164153691354Auxin response factor 1
4ldx_A1e-164153691354Auxin response factor 1
4ldx_B1e-164153691354Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2084824e-72AC208482.1 Populus trichocarpa clone JGIACSB13-H05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299344.20.0hypothetical protein POPTR_0001s13110g
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLB9GMS50.0B9GMS5_POPTR; Auxin response factor
STRINGPOPTR_0001s13110.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.40.0auxin response factor 2